PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G23760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 299aa    MW: 33173.3 Da    PI: 5.8637
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G23760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.3e-192471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+llv++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  LPERR07G23760.1 24 RGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYL 71
                     89********************************************97 PP

2Myb_DNA-binding513.4e-1677120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++ +++++ ++G++ W++Ia++++ gRt++++k++w++
  LPERR07G23760.1  77 RGNMTAEEQLMILELHGRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 120
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6681971IPR017930Myb domain
SuperFamilySSF466895.87E-3122118IPR009057Homeodomain-like
SMARTSM007173.3E-162373IPR001005SANT/Myb domain
PfamPF002494.7E-172471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-232578IPR009057Homeodomain-like
CDDcd001674.33E-122671No hitNo description
PROSITE profilePS5129423.21272126IPR017930Myb domain
SMARTSM007179.5E-1576124IPR001005SANT/Myb domain
PfamPF002497.1E-1577120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2379125IPR009057Homeodomain-like
CDDcd001675.61E-1179120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MMMGHQHEVS SEEETAAAGD ELRRGPWTVE EDLLLVNYIA AHGEGRWNAL ARCAGLKRTG  60
KSCRLRWLNY LRPDVRRGNM TAEEQLMILE LHGRWGNRWS KIAQHLPGRT DNEIKNYWRT  120
RVQKHAKHLN CDVNSQQFKD LMRFLWMPRL LERIQRNQSS SSSSPPSSCS DLEISCVTVD  180
AGGVACQPPP LAMAGVDTSN GCSMWRQQNQ AQMGGGVAAA TVTPAAARQD AHKVFDQMPA  240
AETAACWWSE TESTLLPGVA GFYEDEVAFL PEFDVSGGES MWGGAGGDDA SWYTQMLGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252112424126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1034551e-146AK103455.1 Oryza sativa Japonica Group cDNA clone:J033129J22, full insert sequence.
GenBankHQ8588211e-146HQ858821.1 Oryza sativa Japonica Group isolate UT1319 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645266.11e-131PREDICTED: myb-related protein 340
TrEMBLA0A0D9X3480.0A0A0D9X348_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g48870.11e-130(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-80myb domain protein 112